DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and PRSS3

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:250 Identity:88/250 - (35%)
Similarity:118/250 - (47%) Gaps:49/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGS 92
            ||:.:.:||||......:.||||||  .|||||||||||:|..||:||||.    .:::.||||.
Human   103 PFDDDDKIVGGYTCEENSLPYQVSL--NSGSHFCGGSLISEQWVVSAAHCY----KTRIQVRLGE 161

  Fly    93 TLYNEGGIVVAVRELAYNED------------YNSKTMEYDVGILKLDEKVKETENIRYIELATE 145
              :|       ::.|..||.            ||..|::.|:.::||.........:..|.|.|.
Human   162 --HN-------IKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTT 217

  Fly   146 TPPTGTTAVVTGWGSKCYFW--------CMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMV 202
            .|..||..:::|||:...|.        |:..|...|            |..:..|...|.:||.
Human   218 PPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQ------------AECKASYPGKITNSMF 270

  Fly   203 CA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            |.  .|..||:||.|||||:.....|.|:||||:.||....||||:.|.....||
Human   271 CVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 84/242 (35%)
Tryp_SPc 35..255 CDD:238113 84/241 (35%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 84/242 (35%)
Tryp_SPc 110..328 CDD:238113 85/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.