DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and PRSS2

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:276 Identity:99/276 - (35%)
Similarity:138/276 - (50%) Gaps:51/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLVCLAVGSACAGTVGVSNGDPFEREGRIVGG---EDTTIGAHPYQVSLQTKSGSHFCGGSLIN 67
            :||:...|.:|.|.        ||:.:.:||||   |:.::   ||||||  .||.||||||||:
Human     3 LLLILTFVAAAVAA--------PFDDDDKIVGGYICEENSV---PYQVSL--NSGYHFCGGSLIS 54

  Fly    68 EDTVVTAAHC--------LVGR--KVSKVFVRLGSTLYN----EGG-IVVAVRELAYNEDYNSKT 117
            |..||:|.||        |.||  :..::.||||.  :|    ||. ..:...::..:..|||:|
Human    55 EQWVVSAGHCYKSAINSKLSGRGCEYHRIQVRLGE--HNIEVLEGNEQFINAAKIIRHPKYNSRT 117

  Fly   118 MEYDVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTL------PKTLQEV 176
            ::.|:.::||.........:..|.|.|..|..||.::::|||:       ||      |..||.:
Human   118 LDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGN-------TLSSGADYPDELQCL 175

  Fly   177 YVNIVDWKTCASDEYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASN 239
            ...::....|   |..|...|.::|.|.  .|..||:||||||||:.....|.|||||||.||..
Human   176 DAPVLSQAEC---EASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQK 237

  Fly   240 LLPGVYSDVPALRKWI 255
            ..||||:.|.....||
Human   238 NRPGVYTKVYNYVDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 90/246 (37%)
Tryp_SPc 35..255 CDD:238113 90/245 (37%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 90/246 (37%)
Tryp_SPc 24..256 CDD:238113 92/247 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.