DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and PRSS1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:263 Identity:96/263 - (36%)
Similarity:130/263 - (49%) Gaps:37/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTV 71
            ||:...|.:|.|.        ||:.:.:||||.:....:.||||||  .||.||||||||||..|
Human   229 LLILTFVAAALAA--------PFDDDDKIVGGYNCEENSVPYQVSL--NSGYHFCGGSLINEQWV 283

  Fly    72 VTAAHCLVGRKVSKVFVRLGSTLYN----EGG-IVVAVRELAYNEDYNSKTMEYDVGILKLDEKV 131
            |:|.||.    .|::.||||.  :|    ||. ..:...::..:..|:.||:..|:.::||..:.
Human   284 VSAGHCY----KSRIQVRLGE--HNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRA 342

  Fly   132 KETENIRYIELATETPPTGTTAVVTGWGSKC-----YFWCMTLPKTLQEVYVNIVDWKTCASDEY 191
            .....:..|.|.|..|.|||..:::|||:..     |      |..||.:...::....|   |.
Human   343 VINARVSTISLPTAPPATGTKCLISGWGNTASSGADY------PDELQCLDAPVLSQAKC---EA 398

  Fly   192 KYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKW 254
            .|...|..:|.|.  .|..||:||||||||:.....|.|:||||..||....||||:.|....||
Human   399 SYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKW 463

  Fly   255 ILN 257
            |.|
Human   464 IKN 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 86/232 (37%)
Tryp_SPc 35..255 CDD:238113 86/231 (37%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 86/232 (37%)
Tryp_SPc 249..467 CDD:238113 89/235 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.