DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:268 Identity:89/268 - (33%)
Similarity:123/268 - (45%) Gaps:42/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINE 68
            |.|||..|||  :|...:          :.|||||......:..|.||:|:.:|.|||||:|||:
Zfish     8 LCVLLEILAV--SCQDVI----------QARIVGGYVPAPYSIKYIVSIQSATGQHFCGGTLINK 60

  Fly    69 DTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRE----------LAYNEDYNSKTMEYDVG 123
            ..|:|||||.:|....::..         |...|.:.|          |..:..|:..|...|:.
Zfish    61 YWVLTAAHCNIGEANMRIVA---------GDYSVGLYEGMEQFRRPHMLIPHPQYDRSTNNADIM 116

  Fly   124 ILKLDEKVKETENIRYIELATETP--PTGTTAVVTGWGSKCYFWCMT--LPKTLQEVYVNIVDWK 184
            ::||...|.....:..:.|..:..  ..|....|:|||    |...|  :...|:.|.:.||...
Zfish   117 LIKLQSPVYLNSYVSLVPLPRQDAMVAVGRLCSVSGWG----FTTSTGGISSILRTVKLPIVSTA 177

  Fly   185 TCASDEYKYGEIIYDSMVCA-YEK-KKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSD 247
            .|...:...|.|. ::|:|| |.. .||||:|||||||.....:.||||||..||....||||:.
Zfish   178 VCNGTDSFNGNIT-ENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQYPGVYTA 241

  Fly   248 VPALRKWI 255
            |...|:||
Zfish   242 VSQFRQWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 79/236 (33%)
Tryp_SPc 35..255 CDD:238113 78/235 (33%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 79/236 (33%)
Tryp_SPc 27..252 CDD:238113 80/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.