DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and KLK15

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:270 Identity:79/270 - (29%)
Similarity:128/270 - (47%) Gaps:44/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTV 71
            ||:.|   |....:....:||      :::.|::....:.|:||:|..: |...||.|||:...|
Human     3 LLLTL---SFLLASTAAQDGD------KLLEGDECAPHSQPWQVALYER-GRFNCGASLISPHWV 57

  Fly    72 VTAAHCLVGRKVSKVFVRLGS-TLYNEGG---IVVAVRELAYNEDYNSKTMEYDVGILKLDEKVK 132
            ::||||    :...:.||||. .|....|   :....|.:.:.. |.:::...|:.:|:|.:..:
Human    58 LSAAHC----QSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPR-YEARSHRNDIMLLRLVQPAR 117

  Fly   133 ETENIRYIELATETPPTGTTAVVTGWG--------------SKCYFWCMTLPKTLQEVYVNIVDW 183
            ....:|...|.|..|..|...||:|||              |:     ::||.||....::|:..
Human   118 LNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQ-----VSLPDTLHCANISIISD 177

  Fly   184 KTCASDEYKYGEIIYDSMVCAYEKKK--DACQGDSGGPLAVGNTLVGIVSWG-YACASNLLPGVY 245
            .:|   :..|...:.::||||..:.:  ::|:|||||||..|..|.|||||| ..|.:...||||
Human   178 TSC---DKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVY 239

  Fly   246 SDVPALRKWI 255
            :.|....:||
Human   240 TKVCHYLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 71/241 (29%)
Tryp_SPc 35..255 CDD:238113 71/240 (30%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 71/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.