DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and prss1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001015792.1 Gene:prss1 / 548509 XenbaseID:XB-GENE-5776262 Length:244 Species:Xenopus tropicalis


Alignment Length:262 Identity:99/262 - (37%)
Similarity:139/262 - (53%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTV 71
            |:|.:.:|:|.|          ||.:.:||||...|..|.||||||  .:|.|||||||||...|
 Frog     4 LIVLVLLGAAVA----------FEDDDKIVGGFTCTKNAVPYQVSL--NAGYHFCGGSLINSQWV 56

  Fly    72 VTAAHCLVGRKVSKVFVRLG--STLYNEG-GIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKE 133
            |:||||.    .|::.||||  :...||| ...:..:::..:..|||:.::.|:.::||....:.
 Frog    57 VSAAHCY----KSRIQVRLGEHNIAVNEGTEQFIESQKVIKHPSYNSRNLDNDIMLIKLSTTARL 117

  Fly   134 TENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTL------PKTLQEVYVNIVDWKTCASDEYK 192
            :.||:.:.|.:.....||..:::|||:       ||      |..||.:...|:....| |:.|.
 Frog   118 SSNIQSVPLPSACASAGTNCLISGWGN-------TLSSGTNYPDLLQCLNAPILTASEC-SNSYP 174

  Fly   193 YGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
             |||. ::|.||  ....||:||||||||:.....|.|:|||||.||....||||:.|.....||
 Frog   175 -GEIT-NNMFCAGFLAGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYVSWI 237

  Fly   256 LN 257
            .|
 Frog   238 QN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 89/231 (39%)
Tryp_SPc 35..255 CDD:238113 89/230 (39%)
prss1NP_001015792.1 Tryp_SPc 22..240 CDD:238113 92/234 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.