DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Tpsab1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:244 Identity:91/244 - (37%)
Similarity:130/244 - (53%) Gaps:23/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 REGRIVGGEDTTIGAHPYQVSLQTKS--GSHFCGGSLINEDTVVTAAHCLVGRKV--SKVFVRLG 91
            ||| ||||::.:....|:||||:...  ..||||||||:...|:|||||:...|.  :|:.|:|.
  Rat    63 REG-IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLR 126

  Fly    92 STLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIEL--ATETPPTGTTAV 154
            .........::.|.::..:.|:.......|:.:|||...|..|.|:..:.|  |:||.|:||...
  Rat   127 KQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCW 191

  Fly   155 VTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGE---------IIYDSMVCAYEKKKD 210
            |||||:......:..|..|:||.|.||:.:.|   :.||.:         |:.|.|:||..:..|
  Rat   192 VTGWGNINNDVSLPPPFPLEEVQVPIVENRLC---DLKYHKGLNTGDNVHIVRDDMLCAGNEGHD 253

  Fly   211 ACQGDSGGPLA--VGNTLV--GIVSWGYACASNLLPGVYSDVPALRKWI 255
            :|||||||||.  |.:|.:  |:||||..||....||:|:.|.....||
  Rat   254 SCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 86/239 (36%)
Tryp_SPc 35..255 CDD:238113 86/238 (36%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 86/238 (36%)
Tryp_SPc 66..302 CDD:238113 86/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.