DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and prss60.2

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:279 Identity:102/279 - (36%)
Similarity:139/279 - (49%) Gaps:39/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHRL----VVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQT-KSGSHF 60
            |.||    :.||:|:. ||  ...:.|....|.  ..|||||.:...|:.|:|||||: :.|.||
Zfish     1 MWRLTCATLTLLICVK-GS--LSQLNVCGQAPL--NSRIVGGVNAPEGSWPWQVSLQSPRYGGHF 60

  Fly    61 CGGSLINEDTVVTAAHCLVGRKVSKVFVRLG----------STLYNEGGIVVAVRELAYNEDYNS 115
            ||||||:.:.|:||||||.|...|.:.|.||          .|..|...|:|       :..|||
Zfish    61 CGGSLISSEWVLTAAHCLPGVSESSLVVYLGRRTQQGVNTHETSRNVAKIIV-------HSSYNS 118

  Fly   116 KTMEYDVGILKLDEKVKETENIRYIELATETP--PTGTTAVVTGWGSKCYFWCMTLPKTLQEVYV 178
            .|.:.|:.:|:|...|...:.||.:.||.:..  ..||::.:||||.......:..|..|||..:
Zfish   119 NTNDNDIALLRLSSAVTFNDYIRPVCLAAQNSVYSAGTSSWITGWGDVQAGVNLPAPGILQETMI 183

  Fly   179 NIVDWKTCASDEYKYGE-IIYDSMVCAYEKK--KDACQGDSGGPLAVGNTLV----GIVSWGYAC 236
            .:|....|.:   :.|. .:.::|:||...|  ||.||||||||:......|    ||.||||.|
Zfish   184 PVVANDRCNA---QLGSGTVTNNMICAGLAKGGKDTCQGDSGGPMVTRLCTVWIQAGITSWGYGC 245

  Fly   237 ASNLLPGVYSDVPALRKWI 255
            |....||||:.|...:.||
Zfish   246 ADPNSPGVYTRVSQYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 90/240 (38%)
Tryp_SPc 35..255 CDD:238113 89/239 (37%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 90/240 (38%)
Tryp_SPc 34..267 CDD:238113 91/241 (38%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.