DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Elane

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:267 Identity:72/267 - (26%)
Similarity:108/267 - (40%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINE 68
            |..:|:.|.:|.....:             .||||......|.|:..||| :.|.||||.:||..
Mouse    11 LAAMLLALFLGGPALAS-------------EIVGGRPARPHAWPFMASLQ-RRGGHFCGATLIAR 61

  Fly    69 DTVVTAAHCLVGRKVSKVFVRLGS---TLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEK 130
            :.|::||||:.|.....|.|.||:   ..........:|:.: :...::...:..|:.|::|:..
Mouse    62 NFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRI-FENGFDPSQLLNDIVIIQLNGS 125

  Fly   131 VKETENIRYIELATETPPTG--TTAVVTGWGSKCYFWCMTL------PKTLQEVYVNIVDWKTCA 187
            .....|::..:|..:....|  |..:..|||        .|      |..|||:.|.:|. ..|.
Mouse   126 ATINANVQVAQLPAQGQGVGDRTPCLAMGWG--------RLGTNRPSPSVLQELNVTVVT-NMCR 181

  Fly   188 SDEYKYGEIIYDSMVCAYEKKKDA--CQGDSGGPLAVGNTLVGIVSW--GYACASNLLPGVYSDV 248
            .          ...||....::.|  |.|||||||...|.:.||.|:  | .|.|.|.|..::.|
Mouse   182 R----------RVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRG-GCGSGLYPDAFAPV 235

  Fly   249 PALRKWI 255
            .....||
Mouse   236 AEFADWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 66/235 (28%)
Tryp_SPc 35..255 CDD:238113 66/234 (28%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 66/235 (28%)
Tryp_SPc 29..245 CDD:238113 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.