DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Prss53

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:317 Identity:82/317 - (25%)
Similarity:125/317 - (39%) Gaps:90/317 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINED 69
            |:::..|.......|..|  .|.|..:||..:.||      .|:|.|:: :.|.|.|.|||:.:.
  Rat    15 VIVIEGLQAAQRACGQRG--PGPPEPQEGNTLPGE------WPWQASVR-RQGVHICSGSLVADT 70

  Fly    70 TVVTAAHC---LVGRKVSKVFVRLGSTLYNE----GGIVVAVRELAYNEDYNSKTMEYDVGILKL 127
            .|:|||||   :...::|...|.||| |..|    |...|.|..|...:.||..:...|:.:|:|
  Rat    71 WVLTAAHCFEKMATAELSSWSVVLGS-LKQEGLSPGAEEVGVAALQLPKAYNHYSQGSDLALLQL 134

  Fly   128 DEKVKETENIRYIELATETP----PTGTTAVVTGW------GSKC-------------------Y 163
                  |..|.:..|....|    |.|.:...|||      |..|                   .
  Rat   135 ------THPIVHTTLCLPQPTHHFPFGASCWATGWDQNTSDGKYCPRHKSRESQTGSVLTVLALC 193

  Fly   164 FWCMT--------LP--KTLQEVYVNIVDWKTCASDEYKYGEIIYD-------------SMVC-- 203
            ..|::        ||  :||:.:.:.::...||        ..:|:             .|:|  
  Rat   194 SHCVSELDSTLSPLPVSRTLRNLRLRLISRPTC--------NCLYNRLHQRLLANPARSGMLCGG 250

  Fly   204 AYEKKKDACQGDSGGPLAV----GNTL-VGIVSWGYACASNLLPGVYSDVPALRKWI 255
            |....:..||||||||:..    |:.: |||:|:...||....|.:.:|:.|...|:
  Rat   251 AQPGVQGPCQGDSGGPVMCREPDGHWVQVGIISFTSNCAQEDTPVLLTDMAAHSSWL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 73/286 (26%)
Tryp_SPc 35..255 CDD:238113 73/285 (26%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 74/285 (26%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343300
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.