DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Prss36

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:265 Identity:86/265 - (32%)
Similarity:123/265 - (46%) Gaps:26/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SACAGTVG----VSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAA 75
            ||.:.|.|    :..|.| |...|||||.|...|..|:||||. ..|.|.||||||....|::||
  Rat    36 SAVSPTQGEFEDLDCGRP-EPSSRIVGGSDAHPGTWPWQVSLH-HGGGHICGGSLIAPSWVLSAA 98

  Fly    76 HCLVG----RKVSKVFVRLGSTLYN---EGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKE 133
            ||.|.    ....:..|.||....:   ||..:.:|..:...::|:...:..|:.:|:|....|.
  Rat    99 HCFVTNGTLEPADEWSVLLGVHSQDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKL 163

  Fly   134 TENIRYIEL--ATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEI 196
            ..:::.:.|  |:.....||....||||.......:.:|..||||.:.::....|.....:.|..
  Rat   164 GPSVKPVCLPRASHLFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPF 228

  Fly   197 -----IYDSMVCA-Y-EKKKDACQGDSGGPLAVGN----TLVGIVSWGYACASNLLPGVYSDVPA 250
                 :...|:|| | |.::|.|||||||||...:    .|.||.|:|:.|.....|||::.|..
  Rat   229 NLTLQLLPGMLCAGYPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAH 293

  Fly   251 LRKWI 255
            ...||
  Rat   294 YESWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 77/240 (32%)
Tryp_SPc 35..255 CDD:238113 76/239 (32%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 78/241 (32%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.