DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and try10

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001011209.1 Gene:try10 / 496640 XenbaseID:XB-GENE-6453489 Length:243 Species:Xenopus tropicalis


Alignment Length:251 Identity:90/251 - (35%)
Similarity:129/251 - (51%) Gaps:40/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSK 85
            :|::...|.|.:.:||||...::   ||||||  .:|.||||||||||..||:||||.    .||
 Frog    10 LGLAVAQPIEDDDKIVGGYHCSV---PYQVSL--NAGYHFCGGSLINEHWVVSAAHCY----QSK 65

  Fly    86 VFVRLGSTLYNEGGI--------VVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIEL 142
            :.:|:|     |..|        .:...::..:..|||.|::.|:.:::|.|..:....::.|.|
 Frog    66 MELRIG-----ENNIELLEGTEQFIQSAKIIRHPQYNSWTIDNDIMLIQLQEPAQLNNEVQPIPL 125

  Fly   143 ATETPPTGTTAVVTGWGSKCYFWCMTL------PKTLQEVYVNIVDWKTCASDEYKYGEIIYDSM 201
            .||.||.|:..:::|||:       ||      |..||.:...|:..:.|   ...|...|.|:|
 Frog   126 PTECPPVGSICLISGWGN-------TLSNGVNYPDLLQCIEAPILSDQEC---RQSYPGSITDNM 180

  Fly   202 VCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            :|.  .|...|:||||||||:.....|.|:||||..||....||||:.|.....||
 Frog   181 ICVGYLEGGIDSCQGDSGGPVVCDGELQGVVSWGRGCALPGYPGVYTKVCNYLSWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 85/236 (36%)
Tryp_SPc 35..255 CDD:238113 85/235 (36%)
try10NP_001011209.1 Tryp_SPc 24..239 CDD:238113 87/237 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.