DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and alphaTry

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:262 Identity:119/262 - (45%)
Similarity:164/262 - (62%) Gaps:6/262 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSL 65
            |.::|:||  .||..|..||  |..|...:.:||||||..|||.:.|:|:||| :||||.||||:
  Fly     1 MLKIVILL--SAVVCALGGT--VPEGLLPQLDGRIVGGSATTISSFPWQISLQ-RSGSHSCGGSI 60

  Fly    66 INEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEK 130
            .:.:.:|||||||.....|.:.||.|||.::.||:|..|.....:|.||:.||..|:.:::|...
  Fly    61 YSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSS 125

  Fly   131 VKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGE 195
            :..:.:|:.|.|||..|..|.:|.|:|||::. ....::|..||.|.||||....|||..|.||.
  Fly   126 LSFSSSIKAISLATYNPANGASAAVSGWGTQS-SGSSSIPSQLQYVNVNIVSQSQCASSTYGYGS 189

  Fly   196 IIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILNASE 260
            .|.::|:||....||||||||||||..|..|||:|||||.||.:..||||:||..||.|:::.:.
  Fly   190 QIRNTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTAN 254

  Fly   261 TL 262
            ::
  Fly   255 SI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 106/220 (48%)
Tryp_SPc 35..255 CDD:238113 105/219 (48%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 106/220 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452480
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.850

Return to query results.
Submit another query.