DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and zgc:92590

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:276 Identity:89/276 - (32%)
Similarity:129/276 - (46%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSL 65
            |..:|..|:.|||  ||:.            :.:|:||.:.:..:.|:|:.|...:|..:||.||
Zfish     1 MKMIVFALLVLAV--ACSA------------DDKIIGGYECSPNSQPWQIYLTYDNGQRWCGASL 51

  Fly    66 INEDTVVTAAHC-LVGRKVSKVFVRLGSTLYNEGGIVVAVRE----------LAYNEDYNSKTME 119
            ||:...|:|||| ||..:::   |.||.  :|     |||.|          :..:..||..|::
Zfish    52 INDRWAVSAAHCYLVANRLT---VHLGE--HN-----VAVEEGTEQRIKAEKVIPHPKYNDYTLD 106

  Fly   120 YDVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKC--------YFWCMTLPKTLQEV 176
            .|..::||.|.....:.::.:.|.|.....|...:|:|||:..        ...|:.||..    
Zfish   107 NDFMLIKLKEPAVFNQYVQPVPLTTSCSSEGEQCLVSGWGNLINTGVVYPDVLQCLNLPVL---- 167

  Fly   177 YVNIVDWKTCASDEYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASN 239
                    |.|..|..||..|..:|.||  .|..|||||||||||:.....|.|:|||||.||.:
Zfish   168 --------TRAQCEGAYGWQITKNMFCAGFMEGGKDACQGDSGGPVICNGELRGVVSWGYGCADS 224

  Fly   240 LLPGVYSDVPALRKWI 255
            ..||||::|.....|:
Zfish   225 GYPGVYTEVCRYTDWV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 80/241 (33%)
Tryp_SPc 35..255 CDD:238113 80/240 (33%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 80/241 (33%)
Tryp_SPc 21..243 CDD:238113 81/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.