DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and ctrl

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:259 Identity:95/259 - (36%)
Similarity:133/259 - (51%) Gaps:18/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVCLAVGSACAGTVGVSNGDP-FEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDT 70
            ::.|.|:.::..| .||....| .....|||.||:...|:.|:|||||..:|.|||||||||:..
Zfish     4 IISCFALVASTLG-CGVPAIKPVISGYNRIVNGENAVSGSWPWQVSLQQSNGFHFCGGSLINQYW 67

  Fly    71 VVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELA---YNEDYNSKTMEYDVGILKLDEKVK 132
            |||||||.|  :....:|.||..........|.|:.:|   .:..|||:....|:.:|||....:
Zfish    68 VVTAAHCRV--QAGYHYVILGEHDRGSSAESVQVKSIAKAITHPYYNSQNFNNDITLLKLSSPAQ 130

  Fly   133 ETENIRYIELATETP--PTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGE 195
            .|..|..:.||..:.  |:||..|.||||..   ...:.|:.||:..:.::....|  .:|....
Zfish   131 LTSRISPVCLAASSTSIPSGTRCVTTGWGKT---GSTSSPRILQQTALPLLSPAQC--KQYWGQN 190

  Fly   196 IIYDSMVCAYEKKKDACQGDSGGPLAVGNT----LVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            .|.|:|:||......:|||||||||...::    .|||||||.:..:...|.||:.|..||:||
Zfish   191 RITDAMICAGASGVSSCQGDSGGPLVCESSGAWYQVGIVSWGTSDCNVRTPAVYARVSYLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 87/229 (38%)
Tryp_SPc 35..255 CDD:238113 86/228 (38%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 87/229 (38%)
Tryp_SPc 32..257 CDD:238113 88/230 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4193
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.