DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG7829

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:269 Identity:107/269 - (39%)
Similarity:147/269 - (54%) Gaps:26/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSL 65
            |::|...|:.|. .|.|...  .|..||     |||||....|...||.||:|. .|.|.||||:
  Fly     2 MYKLWWKLLLLQ-ASGCLSL--ESRPDP-----RIVGGFPADIANIPYIVSIQL-YGIHHCGGSI 57

  Fly    66 INEDTVVTAAHCLVG--RKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLD 128
            ||..|::||.|||.|  .::.||.|. |::.|.:.|.:.:|.:|..:|::|.|||:||:||::|.
  Fly    58 INNHTILTAGHCLNGVPHRLLKVKVG-GTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLT 121

  Fly   129 EKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLP--KTLQEVYVNIVDWKTCASDEY 191
            :.:..:..::.|.:..|....||.|.:.|||    |..|..|  .:|:...|.||:...|.:   
  Fly   122 KNLTLSRKVKAIPINPERVAEGTYATIAGWG----FKSMNGPPSDSLRYARVPIVNQTACRN--- 179

  Fly   192 KYGEIIYDSMVCAYEKK--KDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKW 254
            ..|:.:.|.|:||...|  .||||.||||||:|...||||||||..||....|||||.:.||..|
  Fly   180 LLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPW 244

  Fly   255 ---ILNASE 260
               :||.|:
  Fly   245 LDQVLNKSK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 95/229 (41%)
Tryp_SPc 35..255 CDD:238113 94/228 (41%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 94/225 (42%)
Tryp_SPc 28..248 CDD:238113 94/228 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452467
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.