DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and intr

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:336 Identity:69/336 - (20%)
Similarity:114/336 - (33%) Gaps:121/336 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLVVLLVCLAV--GSACAGT-------VG--VSNGDPFEREGRIVGGEDTTIGAHPYQ----VSL 52
            :|..|::.|||  ||....:       ||  .|||.|::.. |::    ..|..:|||    :|.
  Fly     2 QLSQLVIILAVSRGSVYGSSETAPQFNVGEIPSNGQPYQIV-RVI----EYIVPYPYQRSPKISA 61

  Fly    53 QTKSG--------------------------------SHF-----------CGGSLINEDTVVTA 74
            :..||                                .||           |.|:||:...|:|:
  Fly    62 RFSSGGNKEPNSLEIIPAEIETLLTDGQATTEAPKAVKHFVMRILYENKVICSGALISTRLVLTS 126

  Fly    75 AHCLVGRKVSKVFVRL--------------GSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGIL 125
            |.|         |.|.              .|.:|:...::....|              |:.:|
  Fly   127 ALC---------FPRTLRQPPPRSYKLQASRSRIYSVANLITGAIE--------------DMALL 168

  Fly   126 KLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTC---- 186
            .|...: |...:..|:|...  |......||.:.|:         :.|:.:...::....|    
  Fly   169 LLHAPL-EDPFVHPIDLCES--PLRRNDNVTMYMSQ---------QHLRFLRTKLIPNSNCKRSY 221

  Fly   187 ASDEYKYGEIIYDSMVCAYEKKKDA-CQGDSGGPLAVGNTLVGIVSWGYACASNLLPG-VYSDVP 249
            |.||..:   |..:|:||....:.. ||...|..|...:.|.|:..:|..|:...:.| :|:||.
  Fly   222 AQDENAF---ITQTMLCALNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVF 283

  Fly   250 ALRKWILNASE 260
            ..|..:::..|
  Fly   284 KARTELMHLIE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 55/287 (19%)
Tryp_SPc 35..255 CDD:238113 54/286 (19%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 44/209 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.