DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG5255

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:270 Identity:86/270 - (31%)
Similarity:135/270 - (50%) Gaps:25/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQ-TKSGSHFCGGSLIN 67
            |::||..:...|:.|..:..   .|...:.||||||:...|..|||:||| ..||:|.|||::|:
  Fly     2 LLILLPLVLFTSSAASQILY---PPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIID 63

  Fly    68 EDTVVTAAHCLVGRKVSKVFVRLGS-TLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKV 131
            |..::|||||..||:.:...|..|: .|:..|........:..:.:|..:....|:.:|.|:|.:
  Fly    64 ERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESI 128

  Fly   132 KETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTL----PKTLQEVYVNIVDWKTC--ASDE 190
            ......:.:||..|....|:..::||||:      ::|    |..||.:.||.|.::.|  |.|.
  Fly   129 VFDNATQPVELDHEALVPGSRLLLTGWGT------LSLGGDVPARLQSLEVNYVPFEQCRAAHDN 187

  Fly   191 YKYGEIIYDSMVCAY-EKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKW 254
            ....:|   ..||.: :|.:.||.|||||||.....||.:|:||..||.. .|..::.:.....:
  Fly   188 STRVDI---GHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCAKG-YPDAHASISYYHDF 248

  Fly   255 I---LNASET 261
            |   |:.|:|
  Fly   249 IRTHLSLSKT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 76/229 (33%)
Tryp_SPc 35..255 CDD:238113 75/228 (33%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 76/229 (33%)
Tryp_SPc 30..252 CDD:238113 76/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.