DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG31266

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:230 Identity:60/230 - (26%)
Similarity:97/230 - (42%) Gaps:12/230 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGST--- 93
            :||::||.....|..|:..|:|.....|.||..:::|..|:|||.|:.|.:...:.|..|:.   
  Fly    49 QGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWW 113

  Fly    94 -LYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELA-TETPPTGTTAVVT 156
             ||   .....|.::..:.:::......|:.:|:|..|::..:..:.|.|| .:....|......
  Fly   114 DLY---APYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFA 175

  Fly   157 GWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCAYEKKKDACQGDSGGPLA 221
            ||||.....  |..:.|||.....:....|........::....:....:..:.||.||:||||.
  Fly   176 GWGSSEAMG--TYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLI 238

  Fly   222 -VGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
             ....||||.:||..|... .|.||:.......||
  Fly   239 DEQQRLVGIGNWGVPCGRG-YPDVYARTAFYHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 57/226 (25%)
Tryp_SPc 35..255 CDD:238113 56/225 (25%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 57/226 (25%)
Tryp_SPc 52..275 CDD:238113 58/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.