DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG4053

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:77/269 - (28%)
Similarity:139/269 - (51%) Gaps:42/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVCLAVGSACAGTVGVSNGDPFER----EGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLIN 67
            |:..|.:|:    ::.|:.|...:.    :.|||||::...|..|||||:||...:|.|.|.::|
  Fly     7 LIWLLLLGT----SIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILN 67

  Fly    68 EDTVVTAAHCLVGRKVSKVFV------RL--GSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGI 124
            |..::||.||.:...:..:.:      ||  |.||:.:..:|..:.::.|  .||:     |:.:
  Fly    68 EQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPY--VYNN-----DIAL 125

  Fly   125 LKLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKT-------LQEVYVNIVD 182
            :.::|.:...:..:.:||:.|.||.|:|..:||||:         |::       ||.:.:.|:.
  Fly   126 IHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWGA---------PESSYPTVQYLQTLNLTIIA 181

  Fly   183 WKTCASDEYKYGEIIYDSMVCAYEKK-KDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYS 246
            .:.| .:.:.:.:.|....:|.:.:: :.||.|||||||.....|||:|:||.||... :|.:|:
  Fly   182 HEEC-RERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVGLVNWGRACGVG-MPDMYA 244

  Fly   247 DVPALRKWI 255
            :....:.||
  Fly   245 NTVYYQDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 70/236 (30%)
Tryp_SPc 35..255 CDD:238113 69/235 (29%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 70/236 (30%)
Tryp_SPc 35..256 CDD:238113 71/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.