DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG17475

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:268 Identity:90/268 - (33%)
Similarity:131/268 - (48%) Gaps:26/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFE----REG-----RIVGGEDTTIGAHPYQVSLQTKSGSH 59
            ||:||.|.......|..:...:.|..|    .||     |::.|||..:|...||:|||...|.|
  Fly    10 LVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGH 74

  Fly    60 FCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGI 124
            .|||.:|:|..|:|||||:.|...:.:.|..|:..|.:...|..|.|...:.:|||.....|:.:
  Fly    75 ICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIAL 139

  Fly   125 LKLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASD 189
            ::|::.:|..|..:..||.|.....||..::||||| ...|..| |..||:.|:..|.:.||.  
  Fly   140 IRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGS-TELWGDT-PDILQKAYLTHVVYSTCQ-- 200

  Fly   190 EYKYGEIIYDS------MVCAYEK-KKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSD 247
                 ||:.:.      .:|.... .:.||.|||||||.....|.|:|:|||.||.. :|..:::
  Fly   201 -----EIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGYPCALG-VPDSHAN 259

  Fly   248 VPALRKWI 255
            |....:||
  Fly   260 VYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 78/227 (34%)
Tryp_SPc 35..255 CDD:238113 77/226 (34%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 78/227 (34%)
Tryp_SPc 50..269 CDD:238113 79/228 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.