DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Tmprss11c

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:249 Identity:94/249 - (37%)
Similarity:128/249 - (51%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGR------KVSKVFVRLGS 92
            ::.||:|...|..|:|.||| ::..|.||.:||:...::|||||.|..      |||..|     
  Rat   186 KVAGGQDAEEGEWPWQASLQ-QNNVHRCGATLISNSWLITAAHCFVRSANPKDWKVSFGF----- 244

  Fly    93 TLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIEL--ATETPPTGTTAVV 155
             |.::.....||:.:..:|:|:......|:.:::|...|....|||...|  ||:..|..:..||
  Rat   245 -LLSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDVVV 308

  Fly   156 TGWGSKCYFWCMTL------PKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCA--YEKKKDAC 212
            ||||        ||      |..||:..|.|:|.|||.|.: .||.:|...|:||  .|.:.|||
  Rat   309 TGWG--------TLKSDGDSPNILQKGRVKIIDNKTCNSGK-AYGGVITPGMLCAGFLEGRVDAC 364

  Fly   213 QGDSGGPLAVGNT-----LVGIVSWGYACASNLLPGVYSDVPALRKWILNASET 261
            ||||||||...::     |.||||||..||....||||:.|...|.||  :|:|
  Rat   365 QGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI--SSKT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 90/241 (37%)
Tryp_SPc 35..255 CDD:238113 90/240 (38%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 90/241 (37%)
Tryp_SPc 187..415 CDD:238113 92/245 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.