DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Klk4

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:246 Identity:79/246 - (32%)
Similarity:121/246 - (49%) Gaps:39/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYN-E 97
            ||:.|:|....:.|:|.:|.::..:.||.|.|::...|::||||:    .....|.||  |:| |
  Rat    31 RIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCI----QDSYTVGLG--LHNLE 89

  Fly    98 GGIVVAVREL-----AYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTAVVTG 157
            |......|.|     ..:.:||..:...|:.::||:|.|.|:..||.|.:|::.|..|.|.:|:|
  Rat    90 GSQEPGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESNTIRRIPVASQCPTPGDTCLVSG 154

  Fly   158 WG----SKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYD-----SMVCA--YEKKKDA 211
            ||    .|       ||..||.|.:::...:||        .::||     ||.||  ...:||.
  Rat   155 WGRLKNGK-------LPSLLQCVNLSVASEETC--------RLLYDPVYHLSMFCAGGGPDRKDT 204

  Fly   212 CQGDSGGPLAVGNTLVGIVSWGYA-CASNLLPGVYSDVPALRKWILNASET 261
            |.||||||:....:|.|:||.|.. |....:|.||:::.....||....:|
  Rat   205 CNGDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWIWTTIQT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 76/238 (32%)
Tryp_SPc 35..255 CDD:238113 75/237 (32%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 74/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.