DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG10587

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:259 Identity:86/259 - (33%)
Similarity:138/259 - (53%) Gaps:37/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EREG---RIVGGEDTT---IGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGR-KVSKVF 87
            :|.|   |:|||:.||   :|.  |.::|:.:. :..|||:|:::..|:|||||.:|| |:|...
  Fly    38 QRPGFQTRVVGGDVTTNAQLGG--YLIALRYEM-NFVCGGTLLHDLIVLTAAHCFLGRVKISDWL 99

  Fly    88 VRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTT 152
            ...|::..|:.||...|:|:..:.::....|..||.||:|.:.:| .:::..:.|..:....||.
  Fly   100 AVGGASKLNDRGIQRQVKEVIKSAEFREDDMNMDVAILRLKKPMK-GKSLGQLILCKKQLMPGTE 163

  Fly   153 AVVTGWGSKCYFWCMT------LPKTLQEVYVNIVDWKTCAS-------DEYKYGEI-----IYD 199
            ..|:|||       :|      ..|.|:.|.|.:||.|.|.:       :.:|:.::     :.|
  Fly   164 LRVSGWG-------LTENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVHLTD 221

  Fly   200 SMVCA-YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILNASETL 262
            ||.|| ...|||||..||||||...|.:.||||:|..|||....|||:|:..::.:|..:.:.|
  Fly   222 SMFCAGVLGKKDACTFDSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDIMYVKPFIEQSIKVL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 82/243 (34%)
Tryp_SPc 35..255 CDD:238113 81/242 (33%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 82/243 (34%)
Tryp_SPc 46..280 CDD:238113 82/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.