DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Sems

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:240 Identity:82/240 - (34%)
Similarity:122/240 - (50%) Gaps:23/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGEDTT---IGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVF-VRLGSTL 94
            |::||..||   :|.  |.|::: ...:..|||:||:|..|:|||||...|...:.: |..|.:.
  Fly    43 RVIGGRVTTNAKLGG--YLVAMR-YFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISR 104

  Fly    95 YNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWG 159
            .:|.||...|:....:..:...||..||.::.|:..: ..:||..:.|.:.....|.|..|:|||
  Fly   105 LSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTALTPGQTMDVSGWG 168

  Fly   160 SKCYFWCMTLP------KTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCA-YEKKKDACQGDSG 217
                   ||.|      ..|:.|.|.:::.:.| .:.|:....|.|||.|| ...|||||..|||
  Fly   169 -------MTNPDDEGPGHMLRTVSVPVIEKRIC-REAYRESVSISDSMFCASVLGKKDACTYDSG 225

  Fly   218 GPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILNASETL 262
            |||.....:.||||:|..|||...||||:||..::.:|:...:.|
  Fly   226 GPLVYEKQVCGIVSFGIGCASRRYPGVYTDVHYVKPFIVKGIKAL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 80/231 (35%)
Tryp_SPc 35..255 CDD:238113 79/230 (34%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 80/231 (35%)
Tryp_SPc 44..265 CDD:238113 80/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.