DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and ovch1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_956439.2 Gene:ovch1 / 393114 ZFINID:ZDB-GENE-040426-834 Length:556 Species:Danio rerio


Alignment Length:267 Identity:83/267 - (31%)
Similarity:138/267 - (51%) Gaps:30/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CLAVGSACAGTVGVSNGDPFE--REGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVV 72
            |: :...|....|:.:..|.:  .|.||:||::....:.|:||||| .:....|||:::::..|:
Zfish    31 CI-LDKGCDVLAGIRSFVPEDEVEESRIIGGKEAWAHSWPWQVSLQ-YNDVPTCGGAILDQLWVI 93

  Fly    73 TAAHCLVGRKVSKVFVRLGSTLYN------EGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKV 131
            ||.||....|...::..:.. |:|      .....:.|:::..:::||.||.|.|:.:|||...:
Zfish    94 TAGHCFKRYKKPSMWNAVVG-LHNLDNANESSRESIQVQKIFSHKNYNQKTNENDIALLKLQSPL 157

  Fly   132 KETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMT----LPKTLQEVYVNIVDWKTCASDEYK 192
            ..::.:|.|.:.....|...|..||||||      :|    ....||||.|.:.:.:.|  :.:.
Zfish   158 VFSKFVRPIGVFNNDLPPLVTCTVTGWGS------VTENGPQASRLQEVNVTVYEPQKC--NRFY 214

  Fly   193 YGEIIYDSMVC--AYEKKKDACQGDSGGPLAVGN----TLVGIVSWGYACASNLLPGVYSDVPAL 251
            .|::: .||:|  |.|...|||||||||||:..:    .|.|:||||..|.....||||:.:...
Zfish   215 RGKVL-KSMICAGANEGGMDACQGDSGGPLSCFDGERYKLAGVVSWGVGCGRAQKPGVYTTLYHY 278

  Fly   252 RKWILNA 258
            |:|::::
Zfish   279 RQWMVSS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 77/236 (33%)
Tryp_SPc 35..255 CDD:238113 76/235 (32%)
ovch1NP_956439.2 Tryp_SPc 56..281 CDD:214473 77/235 (33%)
Tryp_SPc 57..281 CDD:238113 76/234 (32%)
Tryp_SPc 331..551 CDD:238113
Tryp_SPc 331..549 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.