DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG10469

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:241 Identity:73/241 - (30%)
Similarity:121/241 - (50%) Gaps:23/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGEDTTIGAHPYQVSL-----QTKSGSHFCGGSLINEDTVVTAAHCLVGRKVS--KVFVRLG 91
            ||:.|........||||.|     .:|...:.|||::::...::||||||...|.:  ||.:.:|
  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87

  Fly    92 ST-LYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIEL-ATETPPTGTTAV 154
            .. .:::..|||.......::.::.||:..|:.::||.:|:...:.|:..:| :.:...||..|:
  Fly    88 KVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTYTGRKAI 152

  Fly   155 VTGWGSKCYFWCMTLP-KTLQEVYVNIVDWKTCASDEYKY-----GEIIYDSMVCAYEKKKDACQ 213
            ::|||    .....|| :.||.:...|:..|.|.....|.     .:::::..:|...||...|:
  Fly   153 ISGWG----LTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGLPCR 213

  Fly   214 GDSGGPLAV---GNTLVGIVSWGYACASNL-LPGVYSDVPALRKWI 255
            ||||||:.:   ..|||||||.|:.....| ||.|.:.|.:..|||
  Fly   214 GDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 71/239 (30%)
Tryp_SPc 35..255 CDD:238113 70/238 (29%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 71/239 (30%)
Tryp_SPc 24..260 CDD:238113 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5902
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.