DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG32277

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:242 Identity:76/242 - (31%)
Similarity:121/242 - (50%) Gaps:28/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 REGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGR--KVSKVFVR---- 89
            |:|:|.||:.|.:..|.:.|:|: :.|...|||.:|:.:.|:||||||.||  :|..:.|.    
  Fly    23 RQGKIFGGKTTLVKDHSFLVNLR-RGGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQQ 86

  Fly    90 -LGSTLYNEGGIVVAVRELAY---NEDY-NSKTMEYDVGILKLDEKVKETENIRYIELATETPPT 149
             ||..:..|     .||...|   :.:| ..:.::.|:.:::|........|...:::.....|.
  Fly    87 CLGDDMPPE-----HVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPP 146

  Fly   150 GTTAVVTGWGS---KCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCAYEKK-KD 210
            .:...|.|||:   :.:.|    .:.|||..|.::..:.|........:.:.::|.||..|. :|
  Fly   147 HSNLTVLGWGAINEQGHNW----NQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCALGKNARD 207

  Fly   211 ACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDV--PALRKWI 255
            |||||||||.......||||||||.|.|. .||||:.:  |::..|:
  Fly   208 ACQGDSGGPAIYAGRSVGIVSWGYGCGSG-YPGVYTRLSSPSITYWL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 73/237 (31%)
Tryp_SPc 35..255 CDD:238113 73/236 (31%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 72/230 (31%)
Tryp_SPc 27..246 CDD:238113 72/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.