DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and KLKB1

DIOPT Version :10

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:246 Identity:91/246 - (36%)
Similarity:128/246 - (52%) Gaps:26/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGEDTTIGAHPYQVSLQTK--SGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYN 96
            |||||.:::.|..|:|||||.|  :..|.||||||....|:|||||..|..:..|: |:.|.:.|
Human   401 RIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVW-RIYSGILN 464

  Fly    97 EGGIV-----VAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELAT--ETPPTGTTAV 154
            ...|.     ..::|:..:::|......:|:.::||...:..||..:.|.|.:  :|....|...
Human   465 LSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCW 529

  Fly   155 VTGWG-SKCYFWCMTLPKTLQEVYVNIVDWKTCAS--DEYKYGEIIYDSMVCAYEKK--KDACQG 214
            ||||| ||   ....:...||:|.:.:|..:.|..  .:||    |...||||..|:  ||||:|
Human   530 VTGWGFSK---EKGEIQNILQKVNIPLVTNEECQKRYQDYK----ITQRMVCAGYKEGGKDACKG 587

  Fly   215 DSGGPLAVGNT----LVGIVSWGYACASNLLPGVYSDVPALRKWILNASET 261
            ||||||...:.    ||||.|||..||....||||:.|.....|||..:::
Human   588 DSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQS 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 88/238 (37%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 402..632 CDD:238113 87/237 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.