DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG3650

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:240 Identity:82/240 - (34%)
Similarity:130/240 - (54%) Gaps:10/240 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGVSNGDPFEREGRIVGGEDTTIGA-HPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVS 84
            :|:::|   :.:.|||||..||:.| ..:.|:|: ..|:.:|||||:....||||||||.|.:.|
  Fly    15 LGLASG---QIQPRIVGGTTTTLSAVGGFVVNLR-YDGTFYCGGSLVTSSHVVTAAHCLKGYQAS 75

  Fly    85 KVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPT 149
            ::.|:.|.:..::.|:|..|........::|.::.:|||:::|...:..: .|..|.|.......
  Fly    76 RITVQGGVSKLSQSGVVRRVARYFIPNGFSSSSLNWDVGVIRLQSALTGS-GITTIPLCQVQWNP 139

  Fly   150 GTTAVVTGWGSKCYFWCMTLPKT-LQEVYVNIVDWKTCASDEYKYGEIIYDSMVCAYEKKKDACQ 213
            |....|:|||:..|  ..:.|.. |:.|.:.::..|.| ...|:..:.:..|..||....||:|.
  Fly   140 GNYMRVSGWGTTRY--GNSSPSNQLRTVRIQLIRKKVC-QRAYQGRDTLTASTFCARTGGKDSCS 201

  Fly   214 GDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILNA 258
            |||||.:...|.|.||||||..||:...||||:.|..:|.:||.:
  Fly   202 GDSGGGVIFKNQLCGIVSWGLGCANAQYPGVYTSVHRVRSFILRS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 78/222 (35%)
Tryp_SPc 35..255 CDD:238113 77/221 (35%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 78/222 (35%)
Tryp_SPc 26..243 CDD:238113 77/221 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.