DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG32270

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:235 Identity:89/235 - (37%)
Similarity:125/235 - (53%) Gaps:20/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 REGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLY 95
            |..|||||..:.:...|:.|::: :.|:..|||||:....|:||||||.....|...||.|.|..
  Fly    27 RSPRIVGGHPSDVWHQPHMVNIR-RRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYL 90

  Fly    96 NEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWGS 160
            ::......||::.....|:..|:::||.:|:|.:.: :....:.|.||..:|..|:...|:||| 
  Fly    91 SDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPL-QASIAKPISLAVRSPRPGSFVRVSGWG- 153

  Fly   161 KCYFWCMT------LPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCA-YEKKKDACQGDSGG 218
                  :|      ||..||.|:|.::..:.| .|.|:....|..||.|| ....||||.|||||
  Fly   154 ------LTDSSSTSLPNQLQSVHVQVMPQREC-RDLYRGYRNITSSMFCASVPGLKDACAGDSGG 211

  Fly   219 PLAVGN-TLVGIVSWGYA--CASNLLPGVYSDVPALRKWI 255
            |:...| .|||:||||.|  ||:...|||||||..|..||
  Fly   212 PVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 86/230 (37%)
Tryp_SPc 35..255 CDD:238113 85/229 (37%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 86/230 (37%)
Tryp_SPc 31..254 CDD:238113 87/231 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.