DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and tpr

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:263 Identity:88/263 - (33%)
Similarity:137/263 - (52%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CAGTV-GVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVG 80
            |:..| |::|     .:.|||||::|.:..:|: |::....|..:|..||:|:..::||:||:.|
  Fly   113 CSDCVCGIAN-----IQKRIVGGQETEVHQYPW-VAMLLYGGRFYCAASLLNDQFLLTASHCVYG 171

  Fly    81 RKVSKVFVRL---GSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIEL 142
            .:..::.|||   ...:.:...|...|.|:..:..||::..:.|:.|:||||.|:..|.:.  .:
  Fly   172 FRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLH--PV 234

  Fly   143 ATETPP---TGTTAVVTGWGSKCYFWCMTL----PKTLQEVYVNIVDWKTCASDEYKYGEIIYDS 200
            ...||.   .|...:|||||:      :.:    ..|||||.|.|:....|...  :||..|.|:
  Fly   235 CMPTPGRSFKGENGIVTGWGA------LKVGGPTSDTLQEVQVPILSQDECRKS--RYGNKITDN 291

  Fly   201 MVC-AY-EKKKDACQGDSGGPLAV------GNTLVGIVSWGYACASNLLPGVYSDVPALRKWILN 257
            |:| .| |..||:|||||||||.:      .:.:.|:||||..||....||||:.|.....||.|
  Fly   292 MLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKN 356

  Fly   258 ASE 260
            .::
  Fly   357 LTK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 81/238 (34%)
Tryp_SPc 35..255 CDD:238113 80/237 (34%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 81/238 (34%)
Tryp_SPc 127..356 CDD:238113 82/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.