DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG11192

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:251 Identity:98/251 - (39%)
Similarity:144/251 - (57%) Gaps:21/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSK 85
            |..:...|...:|||||||..||...|||||:|.: |.|.|||::|..|||:|||||......|.
  Fly    14 VAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQ-GRHICGGAIIGIDTVLTAAHCFEDPWSSA 77

  Fly    86 VF-VRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELAT-ETPP 148
            .: ||:||:.:..||.|:::|.:..:.|||.::.:.|:.:|.|:.::..||:::.:.||. ..||
  Fly    78 DYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPP 142

  Fly   149 TGTTAV-VTGWGSKCYFWCMT----LPKTLQEVYVNIVDWKTCASDEYKYGEI--IYDSMVCAYE 206
            |..|.: |:|||.:.....::    :...|:.|.|::|:...|   ...|.::  |...|:||..
  Fly   143 TADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQC---RRAYSQVLPITRRMICAAR 204

  Fly   207 KKKDACQGDSGGPLAVGNT-------LVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            ..:|:||||||||| ||..       |.||||||..||:...||||::|.|.|.||
  Fly   205 PGRDSCQGDSGGPL-VGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 93/236 (39%)
Tryp_SPc 35..255 CDD:238113 92/235 (39%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 93/236 (39%)
Tryp_SPc 28..262 CDD:238113 94/237 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452486
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.