DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Prss48

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:262 Identity:88/262 - (33%)
Similarity:132/262 - (50%) Gaps:67/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVF-VRLGSTLYN 96
            ||||||:|..:|..|:||||:. ..:|.||||||::..|:|||||:.....|.:: |.|||    
Mouse    38 GRIVGGQDAALGRWPWQVSLRF-DYTHSCGGSLISDHWVLTAAHCIKKTWYSFLYSVWLGS---- 97

  Fly    97 EGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETE-NIRYIELATE--------------- 145
                        .:.:|:|...||.|..:.:.:|.:.|| :|..::|::.               
Mouse    98 ------------IDREYSSTGKEYYVSRIAIPDKHRHTEADIALLKLSSRVTFSSVILPICLPNI 150

  Fly   146 ----TPPTGTTAVVTGWG--SKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYG---------- 194
                |.|  .:..|||||  .:.::     |.||||:.|.::..:.|   |..|.          
Mouse   151 SKQLTVP--ASCWVTGWGQNQEGHY-----PSTLQELEVPVISSEAC---EQLYNPIGVFLPDLE 205

  Fly   195 EIIYDSMVCAYEK--KKDACQGDSGGPLAVGN----TLVGIVSWGYACASNLLPGVYSDVPALRK 253
            .:|.:.|.||.|:  :||:|:|||||||:...    .|:|:||||..|..: |||||::|...:|
Mouse   206 RVIKEDMFCAGERQSRKDSCKGDSGGPLSCHIDGVWRLMGVVSWGLECGKD-LPGVYTNVTYYQK 269

  Fly   254 WI 255
            ||
Mouse   270 WI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 85/259 (33%)
Tryp_SPc 35..255 CDD:238113 84/258 (33%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 85/259 (33%)
Tryp_SPc 40..274 CDD:238113 86/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.