DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG8299

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:265 Identity:97/265 - (36%)
Similarity:132/265 - (49%) Gaps:25/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVS--LQTKSGSHFCGGSLI 66
            |..|.|.:...||...|             .||||:...|...|||||  |:|....|.||||:.
  Fly    10 LAALGVVILTDSASIST-------------HIVGGDQADIADFPYQVSVRLETYMLLHICGGSIY 61

  Fly    67 NEDTVVTAAHCLVGRKVSKVFVRLG----STLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKL 127
            ....|:|||||:.||..|.:.:..|    :.|..:|   |.|.:|..:..||.||...|:|::..
  Fly    62 APRVVITAAHCIKGRYASYIRIVAGQNSIADLEEQG---VKVSKLIPHAGYNKKTYVNDIGLIIT 123

  Fly   128 DEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYK 192
            .|.::.:..::.|.:|.|.||:|..|||:|||.:... ...||..|:.|.:.|::..||.:....
  Fly   124 REPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAED-DEALPAMLRAVELQIIEKSTCGAQYLT 187

  Fly   193 YGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            ....:.|.|:||  .|..||.|.|||||||||...|||:||||..|.....||||:.|.:...||
  Fly   188 KDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWI 252

  Fly   256 LNASE 260
            ...:|
  Fly   253 EEQAE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 88/228 (39%)
Tryp_SPc 35..255 CDD:238113 88/227 (39%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 88/228 (39%)
Tryp_SPc 28..255 CDD:238113 90/230 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468517
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.850

Return to query results.
Submit another query.