DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Ser8

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:272 Identity:110/272 - (40%)
Similarity:150/272 - (55%) Gaps:29/272 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVVLLVCLAVGSACAGTVGV-----SNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGG 63
            :...|..||:.:.....:|:     |.|      ||||||..::|...|:||||| :||||||||
  Fly     5 IATFLALLALTNGAVIPIGLEPQTSSLG------GRIVGGTASSIEDRPWQVSLQ-RSGSHFCGG 62

  Fly    64 SLINEDTVVTAAHCL-VGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKL 127
            |:|:.:.:||||||| ....||.:.:|.||.....||::|.|..:..:|.|||.:...|:|:::|
  Fly    63 SIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRL 127

  Fly   128 DEKVKETENIRYIELATETPPTGTTAVVTGWG-------SKCYFWCMTLPKTLQEVYVNIVDWKT 185
            ..|:.....|:.|.:|:.||..|:.|.::|||       |..         ||..|...||....
  Fly   128 KTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSA---------TLLFVDTRIVGRSQ 183

  Fly   186 CASDEYKYGEIIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPA 250
            |.|..|.||..|..:|:||....||||||||||||..|..|||:||||..||....||||:::..
  Fly   184 CGSSTYGYGSFIKATMICAAATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAE 248

  Fly   251 LRKWILNASETL 262
            ||.|:|.|.:|:
  Fly   249 LRDWVLQAQKTV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 99/228 (43%)
Tryp_SPc 35..255 CDD:238113 98/227 (43%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 99/228 (43%)
Tryp_SPc 35..253 CDD:238113 98/227 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452481
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.850

Return to query results.
Submit another query.