DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Prss3

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:246 Identity:91/246 - (36%)
Similarity:128/246 - (52%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSK 85
            |||:...|.:.:.:||||......:.||||||  .||.|||||||||:..||:||||.    .::
  Rat    10 VGVAVAFPVDDDDKIVGGYTCQENSVPYQVSL--NSGYHFCGGSLINDQWVVSAAHCY----KTR 68

  Fly    86 VFVRLGSTLYN--EGG-IVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETP 147
            :.||||....|  ||. ..|...::..:.::|::.:..|:.::||...||....:..:.|.:...
  Rat    69 IQVRLGEHNINVLEGDEQFVNAAKIIKHPNFNARNLNNDIMLIKLSSPVKLNARVATVALPSSCA 133

  Fly   148 PTGTTAVVTGWGSKCYFWCMTL------PKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCA-- 204
            |.||..:::|||:       ||      |..||.:...::....|   |..|...|.::|:|.  
  Rat   134 PAGTQCLISGWGN-------TLSLGVNNPDLLQCLDAPVLPQADC---EASYPGKITNNMICVGF 188

  Fly   205 YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            .|..||:||||||||:.....|.|||||||.||....||||:.|.....||
  Rat   189 LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 85/231 (37%)
Tryp_SPc 35..255 CDD:238113 85/230 (37%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 85/231 (37%)
Tryp_SPc 24..242 CDD:238113 87/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.