DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and kappaTry

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster


Alignment Length:270 Identity:92/270 - (34%)
Similarity:136/270 - (50%) Gaps:24/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTK-----SGSHFCGG 63
            :.:.|:.||:|  .:..:.:| |.|   ||||:.|....|..|||.|||:.:     |..|.|.|
  Fly     1 MCIPLLLLAIG--FSSVISIS-GQP---EGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAG 59

  Fly    64 SLINEDTVVTAAHCLVG--RKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILK 126
            .:|:|..::|:|.||.|  .:...|.|...:|.....|.:..|....::.:|:..|::.|:|:|.
  Fly    60 VIISEQALITSAQCLYGLPEETKLVAVAGANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLL 124

  Fly   127 LDEKVKET-ENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDE 190
            ||..:..| ..|..|.:..|.|..|..|.|.|||.: ..|..:..| |::..|.:|..:.| :..
  Fly   125 LDTTLDLTLLGISSIGIRPERPAVGRLATVAGWGYR-EEWGPSSYK-LEQTEVPVVSSEQC-TQI 186

  Fly   191 YKYGEIIYDSMVCA---YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALR 252
            |..||:. :.|:||   .:...||||||:||||.:...|||:||||..||....|.||..|.:..
  Fly   187 YGAGEVT-ERMICAGFVVQGGSDACQGDTGGPLVIDGQLVGLVSWGRGCARPNYPTVYCYVASFV 250

  Fly   253 KWILNASETL 262
            .||   .||:
  Fly   251 DWI---EETI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 79/231 (34%)
Tryp_SPc 35..255 CDD:238113 78/230 (34%)
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 79/231 (34%)
Tryp_SPc 26..256 CDD:238113 80/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.