DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and PRSS41

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:263 Identity:76/263 - (28%)
Similarity:112/263 - (42%) Gaps:67/263 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCL------------VGRKVSKVF 87
            :.||.::..|..|:|.||:.:. .|.|||||::...|::||||.            :|...|:..
Human    71 VAGGVESARGRWPWQASLRLRR-RHRCGGSLLSRRWVLSAAHCFQKHYYPSEWTVQLGELTSRPT 134

  Fly    88 ---VRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATET--- 146
               :|..|:.|.       |:::..|.|... .:..|:.:|:|...|.....|:.|.:.:.|   
Human   135 PWNLRAYSSRYK-------VQDIIVNPDALG-VLRNDIALLRLASSVTYNAYIQPICIESSTFNF 191

  Fly   147 ---PPTGTTAVVTGWGSKCYFWCMTL----------PKTLQEVYVNIVDWKTCASDEYKYGE--- 195
               |    ...|||||         |          |..|:|..|.|::...|   .|.:.:   
Human   192 VHRP----DCWVTGWG---------LISPSGTPLPPPYNLREAQVTILNNTRC---NYLFEQPSS 240

  Fly   196 --IIYDSMVC--AYEKKKDACQGDSGGPLAVGNT----LVGIVSWGYACASNLLPGVYSDVPALR 252
              :|:|||.|  |.:...|.|:|||||||.....    .|||||||..|.....||||:::....
Human   241 RSMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRPGVYTNISVYF 305

  Fly   253 KWI 255
            .||
Human   306 HWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 74/261 (28%)
Tryp_SPc 35..255 CDD:238113 74/261 (28%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.