DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and l(2)k05911

DIOPT Version :10

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:253 Identity:92/253 - (36%)
Similarity:122/253 - (48%) Gaps:48/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGEDTTIGAHPYQ---VSLQTKSGSHFCGGSLINEDTVVTAAHC---LVGRKVSKVFVRLGS 92
            |||||    |.|.|::   :::..|||..|||||||....::|||||   :....|:.:...||.
  Fly   399 RIVGG----INASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCVARMTSWDVAALTAHLGD 459

  Fly    93 TLYNEG------GIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPP--- 148
              ||.|      .:...::.|..::.:...|:..||.||.|.|.|..|..|:.|.|.|....   
  Fly   460 --YNIGTDFEVQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQPICLPTSPSQQSR 522

  Fly   149 --TGTTAVVTGWGSKCYFWCMTL------PKTLQEVYVNIVDWKTCASDEYKYGEI----IYDSM 201
              :|..|.|.||||        |      |..||:|.:.|.....||.   |||..    |.:||
  Fly   523 SYSGQVATVAGWGS--------LRENGPQPSILQKVDIPIWTNAECAR---KYGRAAPGGIIESM 576

  Fly   202 VCAYEKKKDACQGDSGGPLAVGN----TLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            :||.:..||:|.||||||:.:.:    |.|||||||..|.....||||:.|.:|..||
  Fly   577 ICAGQAAKDSCSGDSGGPMVINDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWI 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 90/251 (36%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
PTZ00449 <198..>376 CDD:185628
Tryp_SPc 400..637 CDD:238113 91/252 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.