DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Phae2

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:273 Identity:93/273 - (34%)
Similarity:136/273 - (49%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HR----LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCG 62
            ||    :::|.||::.||      |::...|   |||:|||:.....:.||.||:| ..|:|:|.
  Fly     4 HRHLATILLLAVCVSQGS------GLALDQP---EGRVVGGKAAAANSAPYIVSMQ-YGGTHYCA 58

  Fly    63 GSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVA----------VRELAYNEDYNSKT 117
            .::||.:.:|||||||..|  ::|   |||||. .|.|.||          :.....|:.|...|
  Fly    59 ANIINSNWLVTAAHCLANR--NQV---LGSTLV-AGSIAVAGTASTTQKRQITHYVINDLYTGGT 117

  Fly   118 MEYDVGILKLDEKVKETENIRYIEL-ATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEV-YVNI 180
            :.||:|::........|..:..::| ::...||| .|.:.||||.......:.||||||. .:.|
  Fly   118 VPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTG-KADLFGWGSTSKTNSPSYPKTLQEAKNIPI 181

  Fly   181 VDWKTCASDEYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWG-YACASNLLP 242
            :...:||:.....|:.::.:.:|.  .......|..||||||..||.|:|||||| ..|.....|
  Fly   182 ISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSP 246

  Fly   243 GVYSDVPALRKWI 255
            .||..|.:...||
  Fly   247 SVYVQVSSFITWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 80/235 (34%)
Tryp_SPc 35..255 CDD:238113 79/234 (34%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 80/235 (34%)
Tryp_SPc 32..262 CDD:238113 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.