DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and PRSS48

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:291 Identity:96/291 - (32%)
Similarity:133/291 - (45%) Gaps:67/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VGSACAGTVG----VSN-----GDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHF-----CGG 63
            ||:...|.:|    :|:     |.|. ...|:|||:|...|..|:||||      ||     |||
Human    21 VGTRETGLLGFHISLSSLSLVCGQPV-YSSRVVGGQDAAAGRWPWQVSL------HFDHNFICGG 78

  Fly    64 SLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVA---------VRELAYNEDYNSKTME 119
            ||::|..::|||||     :...:.....|:: .|.|.|.         |.::..:..|...|. 
Human    79 SLVSERLILTAAHC-----IQPTWTTFSYTVW-LGSITVGDSRKRVKYYVSKIVIHPKYQDTTA- 136

  Fly   120 YDVGILKLDEKVKETENIRYIELATET-----PPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVN 179
             ||.:|||..:|..|..|..|.|.:.|     ||   ...|||||.............|||..|.
Human   137 -DVALLKLSSQVTFTSAILPICLPSVTKQLAIPP---FCWVTGWGKVKESSDRDYHSALQEAEVP 197

  Fly   180 IVDWKTCASDEYKYGEI----------IYDSMVCA--YEKKKDACQGDSGGPLA--VGNTLV--G 228
            |:|.:.|   |..|..|          |.:..:||  .:..||:|:|||||||:  :....:  |
Human   198 IIDRQAC---EQLYNPIGIFLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQTG 259

  Fly   229 IVSWGYACASNLLPGVYSDVPALRKWILNAS 259
            :||||..|..: |||||::|...:||| ||:
Human   260 VVSWGLECGKS-LPGVYTNVIYYQKWI-NAT 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 85/255 (33%)
Tryp_SPc 35..255 CDD:238113 84/254 (33%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 85/255 (33%)
Tryp_SPc 51..288 CDD:238113 87/258 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.