DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and PRSS38

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:267 Identity:83/267 - (31%)
Similarity:122/267 - (45%) Gaps:45/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVS 84
            |..|:.|.| ..||:|:||........|:|||:. .:|.|.||||::||..|::||||....|..
Human    46 TGSVACGRP-SMEGKILGGVPAPERKWPWQVSVH-YAGLHVCGGSILNEYWVLSAAHCFHRDKNI 108

  Fly    85 KVF----------VRLGSTLYNEGGIVVAVRELAYNEDYNS-KTMEYDVGILKLDEKVKETENIR 138
            |::          |....|.:.|      |..:..:..|.. ..:..||.:::|..::..:|::.
Human   109 KIYDMYVGLVNLRVAGNHTQWYE------VNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVL 167

  Fly   139 YIELAT-ETPPTGTTAVVTGWGSKCYFWCMTLPK------TLQEVYVNIVDWKTCASDEYKYGEI 196
            .:.||| |...|......||||        .:.|      .|||:.:.::....|   ...||.:
Human   168 PVCLATPEVNLTSANCWATGWG--------LVSKQGETSDELQEMQLPLILEPWC---HLLYGHM 221

  Fly   197 IY--DSMVCAYE--KKKDACQGDSGGPLAV----GNTLVGIVSWGYACASNLLPGVYSDVPALRK 253
            .|  ..|:||.:  ..|..|:|||||||..    ....:||||||..|::.|.||||:.|....|
Human   222 SYIMPDMLCAGDILNAKTVCEGDSGGPLVCEFNRSWLQIGIVSWGRGCSNPLYPGVYASVSYFSK 286

  Fly   254 WILNASE 260
            ||.:..|
Human   287 WICDNIE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 74/246 (30%)
Tryp_SPc 35..255 CDD:238113 74/245 (30%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.