DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG31954

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:282 Identity:103/282 - (36%)
Similarity:149/282 - (52%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLVVLLVC--LAVGSACAGTVGVSNGDPFE------------REGRIVGGEDTTIGAHPYQVSLQ 53
            ||.|||.|  |.:...|.....|......|            .:||||||....|...|:|||||
  Fly     5 RLFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQ 69

  Fly    54 TKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTM 118
            |  .||.||||:|:|:.::|||||..|:...::.||||::.:...|.::.|:::..:..:|...:
  Fly    70 T--SSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNV 132

  Fly   119 EYDVGILKLDEKVKETENIRYIELATETPPT------GTTAVVTGWGS-----KCYFWCMTLPKT 172
            :||..:|:|...:|..|..:.::|    |.:      |....|:|||:     :...|       
  Fly   133 DYDFSLLQLAHPIKFDETKKAVKL----PESQMKYMDGEACFVSGWGNTQNLLESREW------- 186

  Fly   173 LQEVYVNIVDWKTCASDEYK-YGEIIYDSMVCA--YEKKKDACQGDSGGPL-AVGNTLVGIVSWG 233
            |::|.|.:|:.:.| |::|| ||.:. :.|:||  .|..|||||||||||: :....|||:||||
  Fly   187 LRQVEVPLVNQELC-SEKYKQYGGVT-ERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWG 249

  Fly   234 YACASNLLPGVYSDVPALRKWI 255
            |.||....|||||.|...|.||
  Fly   250 YGCAKPDYPGVYSRVSFARDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 90/235 (38%)
Tryp_SPc 35..255 CDD:238113 89/234 (38%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 90/235 (38%)
Tryp_SPc 51..274 CDD:238113 91/236 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452463
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.850

Return to query results.
Submit another query.