DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG4271

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:207 Identity:66/207 - (31%)
Similarity:105/207 - (50%) Gaps:7/207 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEY 120
            ||.|.|||::|:...|:|||.|:..:.|.::.||:|:.....||.::.|..|..:|:|  |..:.
  Fly    39 SGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGRIIRVTALVVHENY--KNWDN 101

  Fly   121 DVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKT 185
            |:.:|.|::.|... .:..|.|||:.|.........|||.| ......:.:.||.....|.....
  Fly   102 DIALLWLEKPVLSV-RVTKIPLATKEPSENEYPSNAGWGEK-LLESYVVTRKLQNGVTKIRPRSM 164

  Fly   186 CASDEYKYGEIIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPA 250
            ||.:   ..|.:.:.::||:..:.|.|.||.||||.:.|.:|||...|:.|...:||.:|::|..
  Fly   165 CAEE---LVEPVGEELLCAFYTENDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNVFH 226

  Fly   251 LRKWILNASETL 262
            ..:||...:|.|
  Fly   227 YLEWIEENAEKL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 62/198 (31%)
Tryp_SPc 35..255 CDD:238113 62/198 (31%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 64/201 (32%)
Tryp_SPc 19..231 CDD:214473 62/198 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.