DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Send1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:235 Identity:88/235 - (37%)
Similarity:127/235 - (54%) Gaps:15/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTL 94
            |...||:||....|...|:||||| ..|.||||||:.::..::|||||:   |..:..:|.||:|
  Fly    25 EPSERIIGGSSMDITDVPWQVSLQ-YYGEHFCGGSIYSKTIIITAAHCI---KEGERSIRAGSSL 85

  Fly    95 YNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWG 159
            ::.||:||.|.....:..::...||.||.:|||...:..:::|:.|.||...|||.::|:.||||
  Fly    86 HDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWG 150

  Fly   160 SKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCAYEKKKDACQGDSGGPLAVGN 224
            ...:   :..|:.||.|.:.|.....|   :.|||..:::..:||....|..|.|||||||....
  Fly   151 RGNF---LIRPRQLQGVEILIRPLIVC---KLKYGNGVFNEDICAGRMGKGGCYGDSGGPLVFNG 209

  Fly   225 TLVGIVS--WGYACASNLLPGVYSDVPALRKWILNASETL 262
            .||||.|  ....|..:.|   |:.|...|.|||:|.:.|
  Fly   210 QLVGITSRTGNIVCLGSSL---YASVARYRNWILSAIDVL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 82/222 (37%)
Tryp_SPc 35..255 CDD:238113 81/221 (37%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 82/222 (37%)
Tryp_SPc 30..239 CDD:238113 81/221 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452472
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.