DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Ser12

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:264 Identity:99/264 - (37%)
Similarity:139/264 - (52%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSL 65
            :|.||::          |....:|.|...|   |||||....|...|:|.:|. .|..:.||..:
  Fly     3 LHWLVLV----------ASVTLISAGSSPE---RIVGGHPVLISEVPWQAALM-YSEKYICGAVI 53

  Fly    66 INEDTVVTAAHCLVGRKVSKVF-VRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEY-DVGILKLD 128
            .::..::||||| |.|....:: ||:||...|.||....|..:..:|||.|.|:.: |:.:::|.
  Fly    54 YSDKIIITAAHC-VERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLV 117

  Fly   129 EKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKY 193
            :.:.....:|.|:||...|..||.|.|:|||.....|..  |.:|.:..|.|:|...| ...|:|
  Fly   118 DTLIFNAEVRPIQLADSAPAAGTEASVSGWGEIGILWLQ--PTSLLKTSVKILDPNVC-KRSYQY 179

  Fly   194 GEIIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILNA 258
               |..:|:||....||:|.|||||||..|..||||||:|..||:...||||::|..|:.|||||
  Fly   180 ---ITKTMICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNA 241

  Fly   259 SETL 262
            .|.|
  Fly   242 IEQL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 85/222 (38%)
Tryp_SPc 35..255 CDD:238113 84/221 (38%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 85/222 (38%)
Tryp_SPc 24..238 CDD:238113 84/221 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452470
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.