DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Ser6

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:276 Identity:83/276 - (30%)
Similarity:130/276 - (47%) Gaps:43/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLLVC-------LAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCG 62
            |.:|:|       |.|.||           |.:..||:|||||......|:||||: .:|||.||
  Fly     6 VAILLCSFLLFLVLPVQSA-----------PGKLNGRVVGGEDAVKNQFPHQVSLR-NAGSHSCG 58

  Fly    63 GSLINEDTVVTAAHCLVGRKVSKVF---------VRLGSTLYNEGGIVVAVRELAYNEDYNSKTM 118
            ||::....::|||||:....|:.|.         :|.||.....||::|.|.|:..:|:|.:  .
  Fly    59 GSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGN--F 121

  Fly   119 EYDVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDW 183
            ..||.:|:|:..:..:.:|:.|:|.|...|.....|::|||...:..  .||:.||...:..:..
  Fly   122 LNDVALLRLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQG--DLPRYLQYNTLKSITR 184

  Fly   184 KTCASDEYKYGEII---YDSMVC-AYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGV 244
            :.|.       |:|   ::..:| .::....||.||||||....|.|||:..:......:..|..
  Fly   185 QQCE-------ELIDFGFEGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDG 242

  Fly   245 YSDVPALRKWILNASE 260
            |:.|...:.||...|:
  Fly   243 YARVFYFKDWIKKHSD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 71/233 (30%)
Tryp_SPc 35..255 CDD:238113 70/232 (30%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 71/233 (30%)
Tryp_SPc 32..256 CDD:238113 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.