DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Prss53

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:282 Identity:76/282 - (26%)
Similarity:118/282 - (41%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINED 69
            ||::..|.......|..|  .|.|..:||..:.||      .|:|.|:: :.|.|.|.|||:.:.
Mouse    15 VVVIEGLQAAQRACGQRG--PGPPEPQEGNTLPGE------WPWQASVR-RQGVHICSGSLVADT 70

  Fly    70 TVVTAAHC---LVGRKVSKVFVRLGSTLYNE----GGIVVAVRELAYNEDYNSKTMEYDVGILKL 127
            .|:|||||   :...::|...|.||| |..|    |...|.|..|...:.||..:...|:.:|:|
Mouse    71 WVLTAAHCFEKMATAELSSWSVVLGS-LKQEGQSPGAEEVGVAALQLPKAYNHYSQGSDLALLQL 134

  Fly   128 DEKVKETENIRYIELATETP----PTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCAS 188
            .....:|      .|....|    |.|.:...|||...    ...:.:||:.:.:.::...||  
Mouse   135 THPTVQT------TLCLPQPTYHFPFGASCWATGWDQN----TSDVSRTLRNLRLRLISRPTC-- 187

  Fly   189 DEYKYGEIIYD-------------SMVC--AYEKKKDACQGDSGGPLAV----GNTL-VGIVSWG 233
                  ..:|:             .|:|  |...::..||||||||:..    |:.: |||:|:.
Mouse   188 ------NCLYNRLHQRLLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPDGHWVQVGIISFT 246

  Fly   234 YACASNLLPGVYSDVPALRKWI 255
            ..||....|.:.:|:.....|:
Mouse   247 SKCAQEDTPVLLTDMAVHSSWL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 66/251 (26%)
Tryp_SPc 35..255 CDD:238113 66/250 (26%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 6/20 (30%)
Tryp_SPc 45..271 CDD:238113 67/250 (27%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.