DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and tmprss4b

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001119849.1 Gene:tmprss4b / 327651 ZFINID:ZDB-GENE-030131-5862 Length:432 Species:Danio rerio


Alignment Length:267 Identity:101/267 - (37%)
Similarity:137/267 - (51%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINED 69
            ||.:.|    |.|...||         |.|||||.:|:|...|:|||||. :..|.|||||::..
Zfish   185 VVSVSC----SDCGEVVG---------EDRIVGGVETSIEHWPWQVSLQF-NHRHMCGGSLLSTS 235

  Fly    70 TVVTAAHCLVGR--KVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVK 132
            .:::||||..||  ::|:..|.||.|...: .:.|:|..:..::|||..|.::|:.:|||...||
Zfish   236 WIISAAHCFTGRTQELSRWTVVLGQTKVMD-VVGVSVDMIVIHKDYNRLTNDFDIAMLKLTWPVK 299

  Fly   133 ETENIRYIELATETPPTGTTAVVTGWGSKCYFWCM----TLPKTLQEVYVNIVDWKTCASDEYKY 193
            ..|:|..:.|...........||||||      .:    .||..||:..|.:|:...|:.... |
Zfish   300 TGESILPVCLPPHQLAIKDMLVVTGWG------LLKEGGALPTVLQKASVPLVNRSECSKPTI-Y 357

  Fly   194 GEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNT---LVGIVSWGYACASNLLPGVYSDVPALRK 253
            ...|...|:||  .:...|||||||||||...::   |:||||||..||....||||:||..|..
Zfish   358 SSSITPRMLCAGFLQGNVDACQGDSGGPLVYLSSRWQLIGIVSWGVGCAREGKPGVYADVTQLLD 422

  Fly   254 WILNASE 260
            ||....|
Zfish   423 WIYTVME 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 90/231 (39%)
Tryp_SPc 35..255 CDD:238113 89/230 (39%)
tmprss4bNP_001119849.1 SRCR_2 100..179 CDD:292133
SRCR 105..>175 CDD:278931
Tryp_SPc 201..424 CDD:214473 90/231 (39%)
Tryp_SPc 202..427 CDD:238113 91/233 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.